ATP6V1C1 Antibody
| Name | ATP6V1C1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88891 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDC |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ATP6V1C1 Protein |
| Description | Rabbit Polyclonal |
| Gene | ATP6V1C1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ATP6V1C1 Antibody [NBP1-88891] - Analysis in human cell line A-431.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6335_ATP6V1C1-Antibody-Western-Blot-NBP1-88891-img0007.jpg)
Western Blot: ATP6V1C1 Antibody [NBP1-88891] - Analysis in human cell line A-431.
![Immunohistochemistry-Paraffin: ATP6V1C1 Antibody [NBP1-88891] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6336_ATP6V1C1-Antibody-Immunohistochemistry-Paraffin-NBP1-88891-img0002.jpg)
Immunohistochemistry-Paraffin: ATP6V1C1 Antibody [NBP1-88891] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.
![Western Blot: ATP6V1C1 Antibody [NBP1-88891] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6337_ATP6V1C1%2520Antibody-Western%2520Blot-NBP1-88891-img0008.jpg)
Western Blot: ATP6V1C1 Antibody [NBP1-88891] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.