CLIC3 Antibody
| Name | CLIC3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89465 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CLIC3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CLIC3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CLIC3 Antibody [NBP1-89465] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: MCF-7](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17114_CLIC3-Antibody-Western-Blot-NBP1-89465-img0007.jpg)
Western Blot: CLIC3 Antibody [NBP1-89465] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: MCF-7
![Immunocytochemistry/Immunofluorescence: CLIC3 Antibody [NBP1-89465] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17115_CLIC3%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89465-img0011.jpg)
Immunocytochemistry/Immunofluorescence: CLIC3 Antibody [NBP1-89465] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies.
![Immunohistochemistry-Paraffin: CLIC3 Antibody [NBP1-89465] - Staining of human placenta shows moderate nuclear positivity in decidua cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17116_CLIC3-Antibody-Immunohistochemistry-Paraffin-NBP1-89465-img0012.jpg)
Immunohistochemistry-Paraffin: CLIC3 Antibody [NBP1-89465] - Staining of human placenta shows moderate nuclear positivity in decidua cells.
![Simple Western: CLIC3 Antibody [NBP1-89465] - Simple Western lane view shows a specific band for CLIC3 in 0.2 mg/ml of MCF-7 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17117_CLIC3-Antibody-Simple-Western-NBP1-89465-img0009.jpg)
Simple Western: CLIC3 Antibody [NBP1-89465] - Simple Western lane view shows a specific band for CLIC3 in 0.2 mg/ml of MCF-7 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: CLIC3 Antibody [NBP1-89465] - Electropherogram image of the corresponding Simple Western lane view. CLIC3 antibody was used at 1:20 dilution on MCF-7 lysate(s) respectively.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17118_CLIC3-Antibody-Simple-Western-NBP1-89465-img0010.jpg)
Simple Western: CLIC3 Antibody [NBP1-89465] - Electropherogram image of the corresponding Simple Western lane view. CLIC3 antibody was used at 1:20 dilution on MCF-7 lysate(s) respectively.