OPA1 Antibody
| Name | OPA1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-34206 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: KEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | OPA1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | OPA1 |
| Supplier Page | Shop |
![Western Blot: OPA1 Antibody [NBP2-34206] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28051_OPA1-Antibody-Western-Blot-NBP2-34206-img0003.jpg)
![Immunohistochemistry: OPA1 Antibody [NBP2-34206] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28052_OPA1-Antibody-Immunohistochemistry-NBP2-34206-img0001.jpg)