MTHFD2L Antibody

Name MTHFD2L Antibody
Supplier Novus Biologicals
Catalog NBP1-56468
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MTHFD2L(methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like) The peptide sequence was selected from the middle region of MTHFD2L. Peptide sequence TGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVT
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MTHFD2L
Conjugate Unconjugated
Supplier Page Shop

Product images