ACTR10 Antibody

Name ACTR10 Antibody
Supplier Novus Biologicals
Catalog NBP1-56886
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ACTR10(actin-related protein 10 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of ACTR10 (NP_060947). Peptide sequence SLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKAL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ACTR10
Conjugate Unconjugated
Supplier Page Shop

Product images