Name | SF3B14 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57226 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Bovine, Dog, Zebrafish |
Antigen | Synthetic peptides corresponding to SF3B14(splicing factor 3B, 14 kDa subunit) The peptide sequence was selected from the N terminal of SF3B14. Peptide sequence MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRV. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | SF3B6 |
Supplier Page | Shop |