SF3B14 Antibody

Name SF3B14 Antibody
Supplier Novus Biologicals
Catalog NBP1-57226
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Bovine, Dog, Zebrafish
Antigen Synthetic peptides corresponding to SF3B14(splicing factor 3B, 14 kDa subunit) The peptide sequence was selected from the N terminal of SF3B14. Peptide sequence MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRV.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene SF3B6
Supplier Page Shop

Product images