ATP6V1C1 Antibody

Name ATP6V1C1 Antibody
Supplier Novus Biologicals
Catalog NBP1-54902
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ATP6V1C1(ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1) The peptide sequence was selected from the N terminal of ATP6V1C1. Peptide sequence MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ATP6V1C1
Conjugate Unconjugated
Supplier Page Shop

Product images