B3GALNT1 Antibody

Name B3GALNT1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59448
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to B3GALNT1(beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group)) The peptide sequence was selected from the middle region of B3GALNT1. Peptide sequence PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDT
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene B3GALNT1
Conjugate Unconjugated
Supplier Page Shop

Product images