ATP6V1B2 Antibody

Name ATP6V1B2 Antibody
Supplier Novus Biologicals
Catalog NBP1-54759
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ATP6V1B2(ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2) The peptide sequence was selected from the N terminal of ATP6V1B2. Peptide sequence VSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSG
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ATP6V1B2
Conjugate Unconjugated
Supplier Page Shop

Product images