EEF1A2 Antibody

Name EEF1A2 Antibody
Supplier Novus Biologicals
Catalog NBP1-55245
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to EEF1A2(eukaryotic translation elongation factor 1 alpha 2) The peptide sequence was selected from the middle region of EEF1A2. Peptide sequence VIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene EEF1A2
Conjugate Unconjugated
Supplier Page Shop

Product images