eRF1 Antibody
| Name | eRF1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57565 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ETF1 (eukaryotic translation termination factor 1) The peptide sequence was selected from the N terminal of ETF1)(50ug). Peptide sequence ISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ETF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: eRF1 Antibody [NBP1-57565] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: THP - 1 cell lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24347_eRF1%2520Antibody-Western%2520Blot-NBP1-57565-img0004.jpg)
Western Blot: eRF1 Antibody [NBP1-57565] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: THP - 1 cell lysate
![Immunohistochemistry: eRF1 Antibody [NBP1-57565] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in bile ductule Primary Antibody Concentration: 1:100 Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24348_eRF1-Antibody-Immunohistochemistry-NBP1-57565-img0003.jpg)
Immunohistochemistry: eRF1 Antibody [NBP1-57565] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in bile ductule Primary Antibody Concentration: 1:100 Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec