ESD Antibody
| Name | ESD Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57596 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ESD(esterase D/formylglutathione hydrolase) The peptide sequence was selected from the N terminal of ESD. Peptide sequence MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYW. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ESD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ESD Antibody [NBP1-57596] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:1562500 Positive Control: Human kidney](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24150_ESD%2520Antibody-Western%2520Blot-NBP1-57596-img0004.jpg)
Western Blot: ESD Antibody [NBP1-57596] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:1562500 Positive Control: Human kidney
![Immunohistochemistry: ESD Antibody [NBP1-57596] - Formalin Fixed Paraffin Embedded Tissue: Human Heart Tissue Observed Staining: Cytoplasm in endothelial and smooth muscle cells in arterioles Primary Antibody Concentration: 1:100 Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24151_ESD-Antibody-Immunohistochemistry-NBP1-57596-img0003.jpg)
Immunohistochemistry: ESD Antibody [NBP1-57596] - Formalin Fixed Paraffin Embedded Tissue: Human Heart Tissue Observed Staining: Cytoplasm in endothelial and smooth muscle cells in arterioles Primary Antibody Concentration: 1:100 Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec