eIF2B1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57644
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to EIF2B1(eukaryotic translation initiation factor 2B, subunit 1 alpha) The peptide sequence was selected from the C terminal of EIF2B1. Peptide sequence ADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKL.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: EIF2B1
• Conjugate: Unconjugated