PDHA2 Antibody
| Name | PDHA2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79536 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human PDHA2The immunogen for this antibody is PDHA2. Peptide sequence RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PDHA2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PDHA2 Antibody [NBP1-79536] - Human Placenta lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/14661_PDHA2%2520Antibody-Western%2520Blot-NBP1-79536-img0002.jpg)
Western Blot: PDHA2 Antibody [NBP1-79536] - Human Placenta lysate, concentration 0.2-1 ug/ml.