Name | GABA Receptor Epsilon Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-80081 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Guinea Pig, Rabbit |
Antigen | Synthetic peptide directed towards the middle region of human GABRE. Peptide sequence KNSWKLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYVAFQNYV. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | GABRE |
Supplier Page | Shop |