GABA Receptor Epsilon Antibody
| Name | GABA Receptor Epsilon Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80081 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Guinea Pig, Rabbit |
| Antigen | Synthetic peptide directed towards the middle region of human GABRE. Peptide sequence KNSWKLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYVAFQNYV. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GABRE |
| Supplier Page | Shop |
Product images
![Western Blot: GABA Receptor Epsilon Antibody [NBP1-80081] - Human Placenta lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/4462_GABA%2520Receptor%2520Epsilon%2520Antibody-Western%2520Blot-NBP1-80081-img0002.jpg)
Western Blot: GABA Receptor Epsilon Antibody [NBP1-80081] - Human Placenta lysate, concentration 0.2-1 ug/ml.