EXPH5 Antibody

Name EXPH5 Antibody
Supplier Novus Biologicals
Catalog NBP1-80506
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Bovine, Dog, Horse
Antigen Synthetic peptide directed towards the middle region of human EXPH5. Peptide sequence QGRLWKPSFLKNPGFLKDDLRNPPNPSESLSSNSPSSQVPEDGLSPSEPL.
Purity/Format Affinity purified
Description Rabbit Polyclonal
Gene EXPH5
Supplier Page Shop

Product images