TMEM132D Antibody

Name TMEM132D Antibody
Supplier Novus Biologicals
Catalog NBP1-91366
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Antigen The specific Immunogen is proprietary information. Peptide sequence QRPKQEAAISCWVQFSDGSVTPLDIYDEKDFSLMATSLDEKVVSILQDPK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene Tmem132d
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.