ACSBG1 Antibody
| Name | ACSBG1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31990 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: ANVIMVDTQKQLEKILKIWKQLPHLKAVVIYKEPPPNKMANVYTMEEFMELGNEVPEEALDAIIDTQQPNQCCVLV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ACSBG1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ACSBG1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: ACSBG1 Antibody [NBP2-31990] - Staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/1918_ACSBG1-Antibody-Immunohistochemistry-NBP2-31990-img0001.jpg)
Immunohistochemistry: ACSBG1 Antibody [NBP2-31990] - Staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.