B4GALNT1 Antibody

Name B4GALNT1 Antibody
Supplier Novus Biologicals
Catalog NBP1-62535
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to B4GALNT1(beta-1,4-N-acetyl-galactosaminyl transferase 1) The peptide sequence was selected from the N terminal of B4GALNT1. Peptide sequence APWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene B4GALNT1
Conjugate Unconjugated
Supplier Page Shop

Product images