SLC24A1 Antibody

Name SLC24A1 Antibody
Supplier Novus Biologicals
Catalog NBP1-62521
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC24A1(solute carrier family 24 (sodium/potassium/calcium exchanger), member 1) The peptide sequence was selected from the middle region of SLC24A1. Peptide sequence EQLSRRPVAKVMALEDLSKPGDGAIAVDELQDNKKL
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC24A1
Conjugate Unconjugated
Supplier Page Shop

Product images