COQ2 Antibody
| Name | COQ2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59613 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to COQ2(coenzyme Q2 homolog, prenyltransferase (yeast)) The peptide sequence was selected from the middle region of COQ2. Peptide sequence FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | COQ2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: COQ2 Antibody [NBP1-59613] - Sample Tissue: Human MCF7 Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6985_COQ2-Antibody-Western-Blot-NBP1-59613-img0003.jpg)
![Western Blot: COQ2 Antibody [NBP1-59613] - DU145 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6986_COQ2-Antibody-Western-Blot-NBP1-59613-img0002.jpg)