CML2 Antibody

Name CML2 Antibody
Supplier Novus Biologicals
Catalog NBP1-60012
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen Synthetic peptides corresponding to NAT8B(N-acetyltransferase 8B (gene/pseudogene)) The peptide sequence was selected from the middle region of NAT8B. Peptide sequence SCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKA.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene NAT8B
Supplier Page Shop

Product images