ZNF579 Antibody

Name ZNF579 Antibody
Supplier Novus Biologicals
Catalog NBP1-68922
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ZNF579 (zinc finger protein 579) The peptide sequence was selected from the C terminal of ZNF579. Peptide sequence LASYLRQHRRVHGPLSLLAPLPAAGKKDDKASGARNSAKGPEGGEGAECG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZNF579
Conjugate Unconjugated
Supplier Page Shop

Product images