MPPE1 Antibody
| Name | MPPE1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69305 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MPPE1(metallophosphoesterase 1) The peptide sequence was selected from the N terminal of MPPE1. Peptide sequence WLLQPEVVFILGDIFDEGKWSTPEAWADDVERFQKMFRHPSHVQLKVVAG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MPPE1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MPPE1 Antibody [NBP1-69305] - This Anti-MPPE1 antibody was used in Western Blot of Transfected 293T tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16538_MPPE1%2520Antibody-Western%2520Blot-NBP1-69305-img0001.jpg)
Western Blot: MPPE1 Antibody [NBP1-69305] - This Anti-MPPE1 antibody was used in Western Blot of Transfected 293T tissue lysate at a concentration of 1ug/ml.