5033411D12Rik Antibody

Name 5033411D12Rik Antibody
Supplier Novus Biologicals
Catalog NBP1-98273
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen The immunogen for this antibody is 5033411D12Rik antibody - C-terminal region of mouse protein (NP_619595). Peptide sequence ANYLIGQKEAKRWGTAHGSIVPYQAFKTKDGYLVIGAGNNQQFAVVCKIL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene Sugct
Conjugate Unconjugated
Supplier Page Shop

Product images