PCSK1N Antibody (1E9)

• Supplier: Novus Biologicals
• Catalog: H00027344-M02
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone: 1E9
• Applications: WB ELISA ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: PCSK1N (NP_037403, 173 a.a. ~ 260a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADSEGVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPARRLLPP
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: PCSK1N
• Conjugate: Unconjugated

Product images

Western Blot: PCSK1N Antibody (1E9) [H00027344-M02] - Analysis of PCSK1N expression in transfected 293T cell line by PCSK1N monoclonal antibody (M02), clone 1E9.Lane 1: PCSK1N transfected lysate (Predicted MW: 27.4 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: PCSK1N Antibody (1E9) [H00027344-M02] - Analysis of monoclonal antibody to PCSK1N on HeLa cell. Antibody concentration 20 ug/ml.

Immunohistochemistry-Paraffin: PCSK1N Antibody (1E9) [H00027344-M02] - Analysis of monoclonal antibody to PCSK1N on formalin-fixed paraffin-embedded human cerebellum. Antibody concentration 3 ug/ml.

Sandwich ELISA: PCSK1N Antibody (1E9) [H00027344-M02] - Detection limit for recombinant GST tagged PCSK1N is 0.1 ng/ml as a capture antibody.