Tryptophan rich protein Antibody (2A3)
| Name | Tryptophan rich protein Antibody (2A3) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00007485-M04 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 2A3 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | WRB (NP_004618, 29 a.a. - 101 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSFSSFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIK |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | WRB |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Tryptophan rich protein Antibody (2A3) [H00007485-M04] - WRB monoclonal antibody (M04), clone 2A3 Western Blot analysis of WRB expression in IMR-32 ( Cat # L008V1 ).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/12040_Tryptophan-rich-protein-Antibody-(2A3)-Western-Blot-H00007485-M04-img0001.jpg)
Western Blot: Tryptophan rich protein Antibody (2A3) [H00007485-M04] - WRB monoclonal antibody (M04), clone 2A3 Western Blot analysis of WRB expression in IMR-32 ( Cat # L008V1 ).
![ELISA: Tryptophan rich protein Antibody (2A3) [H00007485-M04] - Detection limit for recombinant GST tagged WRB is approximately 0.1ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/12041_Tryptophan-rich-protein-Antibody-(2A3)-ELISA-H00007485-M04-img0002.jpg)
ELISA: Tryptophan rich protein Antibody (2A3) [H00007485-M04] - Detection limit for recombinant GST tagged WRB is approximately 0.1ng/ml as a capture antibody.