GPR175 Antibody
| Name | GPR175 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13470 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: MDTLEEVTWANGSTALPPPLAPNISVPHRCLLLLYEDIGTSR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GPR175 Protein |
| Description | Rabbit Polyclonal |
| Gene | TPRA1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: GPR175 Antibody [NBP2-13470] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/4228_GPR175-Antibody-Immunohistochemistry-NBP2-13470-img0002.jpg)
Immunohistochemistry: GPR175 Antibody [NBP2-13470] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.