Complement Factor H-related 1/CFHR1/CFHL1 Antibody

Name Complement Factor H-related 1/CFHR1/CFHL1 Antibody
Supplier Novus Biologicals
Catalog NBP2-14475
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: YKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCTEEGWS
Purity/Format Immunogen affinity purified
Blocking Peptide Complement Factor H-related 1/CFHR1/CFHL1 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene CFHR1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.