beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody
| Name | beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88655 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:FRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | beta-1,4-Galactosyltransferase 1/B4GalT1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | B4GALT1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody [NBP1-88655] - Staining of human cell line HeLa shows localization to the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7005_beta-1-4-Galactosyltransferase-1-B4GalT1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88655-img0003.jpg)
Immunocytochemistry/Immunofluorescence: beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody [NBP1-88655] - Staining of human cell line HeLa shows localization to the Golgi apparatus.
![Immunohistochemistry: beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody [NBP1-88655] - Staining of human lateral ventricle shows strong granular cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7006_beta-1-4-Galactosyltransferase-1-B4GalT1-Antibody-Immunohistochemistry-NBP1-88655-img0002.jpg)
Immunohistochemistry: beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody [NBP1-88655] - Staining of human lateral ventricle shows strong granular cytoplasmic positivity in neuronal cells.