MSANTD1 Antibody
| Name | MSANTD1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30724 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GYLVSPQAEKHRRARNWTDAEMRGLMLVWEEFFDELKQTKRNAKVYEKMASKLFEMTGERRLGEEIKIKITNMTFQ |
| Description | Rabbit Polyclonal |
| Gene | MSANTD1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: MSANTD1 Antibody [NBP2-30724] - Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in goblet cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/26966_MSANTD1-Antibody-Immunohistochemistry-NBP2-30724-img0001.jpg)
Immunohistochemistry: MSANTD1 Antibody [NBP2-30724] - Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in goblet cells.