MDR3/ABCB4 Antibody

Name MDR3/ABCB4 Antibody
Supplier Novus Biologicals
Catalog NBP2-30887
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: HSELMKKEGVYFKLVNMQTSGSQIQSEEFELNDEKAATRMAPNGWKSRLFRHSTQKNLKNSQMCQKSLDVETDGLEANVPPVS
Purity/Format Immunogen affinity purified
Blocking Peptide MDR3/ABCB4 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene ABCB4
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.