Name | ATP6V0E2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55100 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to ATP6V0E2(ATPase, H+ transporting V0 subunit e2) The peptide sequence was selected from the middle region of ATP6V0E2. Peptide sequence TVAPLSLTTPSSGPSPTQLCLVTSSLLLAPRDPDPQGLPGSWKSSQSSQP. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | ATP6V0E2 |
Supplier Page | Shop |