ATP6V0E2 Antibody

Name ATP6V0E2 Antibody
Supplier Novus Biologicals
Catalog NBP1-55100
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ATP6V0E2(ATPase, H+ transporting V0 subunit e2) The peptide sequence was selected from the middle region of ATP6V0E2. Peptide sequence TVAPLSLTTPSSGPSPTQLCLVTSSLLLAPRDPDPQGLPGSWKSSQSSQP.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene ATP6V0E2
Supplier Page Shop

Product images