FUT6 Antibody

Name FUT6 Antibody
Supplier Novus Biologicals
Catalog NBP1-57936
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FUT6(fucosyltransferase 6 (alpha (1,3) fucosyltransferase)) The peptide sequence was selected from the C terminal of FUT6. Peptide sequence YITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLAR.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene FUT6
Supplier Page Shop

Product images