ADAM2 Antibody

Name ADAM2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59224
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ADAM2(ADAM metallopeptidase domain 2 (fertilin beta)) The peptide sequence was selected from the middle region of ADAM2. Peptide sequence PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVIL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ADAM2
Conjugate Unconjugated
Supplier Page Shop

Product images