SI Sucrase-Isomaltase Antibody
| Name | SI Sucrase-Isomaltase Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69357 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SI(sucrase-isomaltase (alpha-glucosidase)) The peptide sequence was selected from the N terminal of SI. Peptide sequence NSVLFTTQNQTPNRFRFKITDPNNRRYEVPHQYVKEFTGPTVSDTLYDVK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SI |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SI Sucrase-Isomaltase Antibody [NBP1-69357] - This Anti-SI antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24261_SI%2520Sucrase-Isomaltase%2520Antibody-Western%2520Blot-NBP1-69357-img0001.jpg)
Western Blot: SI Sucrase-Isomaltase Antibody [NBP1-69357] - This Anti-SI antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.