Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-69352
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to GNS(glucosamine (N-acetyl)-6-sulfatase (Sanfilippo disease IIID)) The peptide sequence was selected from the C terminal of GNS. Peptide sequence PILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDA.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: GNS
• Conjugate: Unconjugated