Klkbl4 Antibody

Name Klkbl4 Antibody
Supplier Novus Biologicals
Catalog NBP1-57617
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KLKBL4 The peptide sequence was selected from the C terminal of KLKBL4 (NP_001073961). Peptide sequence EASVQPLYYDYYGGEVGEGRIFAGQNRLYQPEEIILVSFVLVFFCSSI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PRSS54
Conjugate Unconjugated
Supplier Page Shop

Product images