TBC1D10A Antibody
| Name | TBC1D10A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79842 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human TBC1D10AThe immunogen for this antibody is TBC1D10A. Peptide sequence: GRGQLEKPPAPNQAMVVAAAGDACPPQHVPPKDSAPKDSAPQDLAPQVSA |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TBC1D10A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: TBC1D10A Antibody [NBP1-79842] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6927_TBC1D10A-Antibody-Western-Blot-NBP1-79842-img0002.jpg)
![Western Blot: TBC1D10A Antibody [NBP1-79842] - Human sperm extract.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6928_TBC1D10A%2520Antibody-Western%2520Blot-NBP1-79842-img0003.jpg)