PMM2/Phosphomannomutase 2 Antibody (2E9.)
| Name | PMM2/Phosphomannomutase 2 Antibody (2E9.) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00005373-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2b Kappa |
| Clone | 2E9. |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | PMM2 (NP_000294, 47 a.a. - 111 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIK |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | PMM2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PMM2/Phosphomannomutase 2 Antibody (2E9) [H00005373-M01] - Analysis of PMM2 expression in transfected 293T cell line by PMM2 monoclonal antibody (M01), clone 2E9.Lane 1: PMM2 transfected lysate(28.1 KDa).Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/27641_PMM2-Phosphomannomutase%25202%2520Antibody%2520(2E9)-Western%2520Blot-H00005373-M01-img0003.jpg)
Western Blot: PMM2/Phosphomannomutase 2 Antibody (2E9) [H00005373-M01] - Analysis of PMM2 expression in transfected 293T cell line by PMM2 monoclonal antibody (M01), clone 2E9.Lane 1: PMM2 transfected lysate(28.1 KDa).Lane 2: Non-transfected lysate.
![ELISA: PMM2/Phosphomannomutase 2 Antibody (2E9.) [H00005373-M01] - PMM2/Phosphomannomutase 2 Antibody (2E9) [H00005373-M01] - Detection limit for recombinant GST tagged PMM2 is 0.1 ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/27642_PMM2-Phosphomannomutase-2-Antibody-(2E9.)-ELISA-H00005373-M01-img0004.jpg)
ELISA: PMM2/Phosphomannomutase 2 Antibody (2E9.) [H00005373-M01] - PMM2/Phosphomannomutase 2 Antibody (2E9) [H00005373-M01] - Detection limit for recombinant GST tagged PMM2 is 0.1 ng/ml as a capture antibody.