| Name | CKS2 Antibody (1G8) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00001164-M03 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2b Kappa |
| Clone | 1G8 |
| Applications | WB ELISA ICC/IF |
| Species Reactivities | Human |
| Antigen | CKS2 (NP_001818, 1 a.a. - 79 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | CKS2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |