ATP6V0D2 Antibody

Name ATP6V0D2 Antibody
Supplier Novus Biologicals
Catalog NBP1-54595
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ATP6V0D2(ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2) The peptide sequence was selected from the middle region of ATP6V0D2. Peptide sequence GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ATP6V0D2
Conjugate Unconjugated
Supplier Page Shop

Product images