Anti- EID2 antibody
| Name | Anti- EID2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab125373 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat, Guinea Pig, Bovine, Dog, Human |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 155-204 ( QFLRHYLENYPIAPGRIQELEERRRRFVEACRAREAAFDIEYLRNPQRVD ) of Mouse EID2 (NM_198425) |
| Description | Rabbit Polyclonal |
| Gene | EID2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti- EID2 antibody (ab125373) at 1 µg/ml + Mouse kidney lysate at 10 µg