Anti- KIAA1549 antibody
| Name | Anti- KIAA1549 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab118721 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within C-terminal amino acids 758-807 ( QVPRTSGREPSAPSGNLPHRGLQGPGLGYPTSSTEDLQPGHSSASLIKAI ) of Human KIAA1549 (AAH38232) |
| Description | Rabbit Polyclonal |
| Gene | KIAA1549 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
