Anti-5HT3E antibody
| Name | Anti-5HT3E antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85596 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF ICC/IF WB |
| Species Reactivities | Human, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 360-409 of Human 5HT3E; RWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPG (NP_872395) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | HTR3E |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
