Anti-A2BP1 / Fox1 antibody
| Name | Anti-A2BP1 / Fox1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83454 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Horse, Bovine, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 346-395 ( TAAAYSDRNQFVFVAADEISCNTSAVTDEFMLPTPTTTHLLQPPPTALVP ) of Human A2BP1/ Fox1 (NP_665900) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | RBFOX1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-A2BP1 / Fox1 antibody (ab83454) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal brain lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution