| Name | Anti-C5R1 antibody [P12/1] |
|---|---|
| Supplier | Abcam |
| Catalog | ab24036 |
| Prices | $373.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a |
| Clone | P12/1 |
| Applications | FC WB IHC-F IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide: MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN , corresponding to N terminal amino acids 1-31 of Human C5R1 |
| Description | Mouse Monoclonal |
| Gene | C5AR1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |