Anti-C5R1 antibody [P12/1]
| Name | Anti-C5R1 antibody [P12/1] |
|---|---|
| Supplier | Abcam |
| Catalog | ab33212 |
| Prices | $378.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a |
| Clone | P12/1 |
| Applications | FC IHC-F WB |
| Species Reactivities | Human, Monkey |
| Antigen | Synthetic peptide: MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN , corresponding to N terminal amino acids 1-31 of Human C5R1 Run BLAST with Run BLAST with |
| Description | Mouse Monoclonal |
| Gene | C5AR1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
FACS analysis of C5R1 expressing cells in human peripheral blood granulocytes using ab33212.