Anti-CCNYL1 antibody
| Name | Anti-CCNYL1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87161 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Goat, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 72-121 ( VKCVTLAIYYHIKNRDANRSLDIFDERSHPLTREKVPEEYFKHDPEHKFI ) of Human CCNYL1 (NP_689736) |
| Description | Rabbit Polyclonal |
| Gene | CCNYL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CCNYL1 antibody (ab87161) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal brain lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution