Name | Anti-CCNYL1 antibody |
---|---|
Supplier | Abcam |
Catalog | ab87161 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Goat, Horse, Guinea Pig, Bovine, Cat, Dog |
Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 72-121 ( VKCVTLAIYYHIKNRDANRSLDIFDERSHPLTREKVPEEYFKHDPEHKFI ) of Human CCNYL1 (NP_689736) |
Description | Rabbit Polyclonal |
Gene | CCNYL1 |
Conjugate | Unconjugated |
Supplier Page | Shop |