| Name | ACCN5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1510 |
| Prices | $315.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ACCN5 antibody was raised using the middle region of ACCN5 corresponding to a region with amino acids FTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVD |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | ACCN5 Blocking Peptide |
| Description | Rabbit polyclonal ACCN5 antibody raised against the middle region of ACCN5 |
| Gene | ASIC5 |
| Supplier Page | Shop |