Name | ACCN5 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1510 |
Prices | $315.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | ACCN5 antibody was raised using the middle region of ACCN5 corresponding to a region with amino acids FTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVD |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | ACCN5 Blocking Peptide |
Description | Rabbit polyclonal ACCN5 antibody raised against the middle region of ACCN5 |
Gene | ASIC5 |
Supplier Page | Shop |